Protein Info for GFF4358 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01200701: possible membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00426: competence protein ComEA helix-hairpin-helix repeat region" amino acids 56 to 124 (69 residues), 117.9 bits, see alignment E=7.7e-39 PF12836: HHH_3" amino acids 60 to 118 (59 residues), 68.6 bits, see alignment E=6.1e-23 PF03934: T2SSK" amino acids 65 to 112 (48 residues), 27.4 bits, see alignment E=5.5e-10

Best Hits

Swiss-Prot: 83% identical to YBAV_SHIFL: Uncharacterized protein YbaV (ybaV) from Shigella flexneri

KEGG orthology group: K02237, competence protein ComEA (inferred from 99% identity to sei:SPC_0467)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (124 amino acids)

>GFF4358 FIG01200701: possible membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKHGIKALLITLSLTCAGMAHSALAATPVAKNAAVETKADTPSSSSAKAALPAKASDDEG
TRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVDDLKQVPGMGSALVERNLA
VLTL