Protein Info for GFF4358 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG01200701: possible membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00426: competence protein ComEA helix-hairpin-helix repeat region
  • amino acids 56 to 124 (69 residues), 117.9 bits, E=7.7e-39
• PF12836: HHH_3
  • amino acids 61 to 118 (58 residues), 68.6 bits, E=6.1e-23
• PF03934: T2SSK
  • amino acids 65 to 113 (49 residues), 27.6 bits, E=4.6e-10

Best Hits

Swiss-Prot: 83% identical to YBAV_SHIFL: Uncharacterized protein YbaV (ybaV) from Shigella flexneri

KEGG orthology group: K02237, competence protein ComEA (inferred from 99% identity to sei:SPC_0467)

Predicted SEED Role

"FIG01200701: possible membrane protein"

Protein Sequence (124 amino acids)

>GFF4358 FIG01200701: possible membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKHGIKALLITLSLTCAGMAHSALAATPVAKNAAVETKADTPSSSSAKAALPAKASDDEG
TRVSINTASAEDLARVMNGVGLKKAQAIVSYREEYGPFKTVDDLKQVPGMGSALVERNLA
VLTL