Protein Info for GFF4357 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 6 to 203 (198 residues), 227.1 bits, E=1.2e-71
• PF00117: GATase
  • amino acids 7 to 199 (193 residues), 132.1 bits, E=5.2e-42
• PF07722: Peptidase_C26
  • amino acids 72 to 182 (111 residues), 37.9 bits, E=4.4e-13
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 213 to 538 (326 residues), 470 bits, E=3.5e-145
• PF02540: NAD_synthase
  • amino acids 215 to 253 (39 residues), 28.6 bits, 1.9e-10
• PF00958: GMP_synt_C
  • amino acids 452 to 537 (86 residues), 140.7 bits, E=3.1e-45

Best Hits

Swiss-Prot: 86% identical to GUAA_METPP: GMP synthase [glutamine-hydrolyzing] (guaA) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 90% identity to adn:Alide_1954)

MetaCyc: 62% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (538 amino acids)

>GFF4357 GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MQHQKILILDFGSQVTQLIARRVREAHVYCEVHPCDVSSEWVREFAADGQLKGVILSGSH
ASVYEVDDKAPEAVYELGIPVLGICYGMQTMAQQLGGKVEGSHTREFGYAEVRARGHTAL
LKNIADFTTPEGHGMLKVWMSHGDKVTELPPGFKLMASTASCPIAGMADEERRFYAVQFH
PEVTHTVQGRALLERFVLEICGTNPDWVMRDHIAEAVEKIREQVGDEEVILGLSGGVDSS
VAAALIHRAIGDQLTCVFVDHGLLRLNEGDMVMDMFVGKLHAKVIRVDAADQFLGHLAGV
SDPEAKRKIIGREFVEVFKAEAAKLISSGASTKGAKWLAQGTIYPDVIESGGAKSKKAVT
IKSHHNVGGLPEQLGLKLLEPLRDLFKDEVRELGVALGLPHDMVYRHPFPGPGLGVRILG
EVKKDYADLLRRADAIFIEELRSTVDPHSGKTWYELTSQAFTVFLPVKSVGVMGDGRTYD
YVVALRAVQTSDFMTADWAELPYALLKKVSGRIINEVRGINRVTYDVSSKPPATIEWE