Protein Info for PS417_22305 in Pseudomonas simiae WCS417

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 29 (7 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details PF00672: HAMP" amino acids 169 to 222 (54 residues), 28.9 bits, see alignment 2.3e-10 PF00512: HisKA" amino acids 228 to 290 (63 residues), 49.7 bits, see alignment E=6.1e-17 PF02518: HATPase_c" amino acids 336 to 440 (105 residues), 82 bits, see alignment E=8.8e-27

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU4886)

Predicted SEED Role

"Putative two-component system sensor kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U375 at UniProt or InterPro

Protein Sequence (447 amino acids)

>PS417_22305 histidine kinase (Pseudomonas simiae WCS417)
MRSLFWRILASFWLAIALVAGLSILLGHMLNQDAWILSRHPGLNNLAEEWTQLYEAQGED
AAQDLLQQRKRQYHIDVQVLNESGEPVVRGTFPRRAAAFEARQNDSQDGHLPWRRLTAEY
TSEKTGDTYLLIYRIPHPELDAWHRSSLLWPLSALAIALVVLTLFSLLVTLSITRPLSRL
RGAVHDLGQATYQQNSLARLANRRDEFGVLATDFNRMGARLQSLIGSQRQLLRDVSHELR
SPLARLRIALALAERASPEERERLWPRLTRECDRLEALISEILVLARVDADNASAEEVDL
TALLKTLQKDAQLGAPDQVVQLNAETDLHLKGWPTMIERAVDNLLRNAQRFNPQGQPIEL
QAQRQGDRILISVRDHGPGVEAEHLSQLGEPFYRAPGQTAQGHGLGLAIARRAAERHGGS
LILANHPGGGFVASIDLPLEPGVVTPA