Protein Info for GFF4355 in Variovorax sp. SCN45

Annotation: Alcohol dehydrogenase (EC 1.1.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 143 to 160 (18 residues), see Phobius details amino acids 172 to 193 (22 residues), see Phobius details PF08240: ADH_N" amino acids 26 to 139 (114 residues), 81.2 bits, see alignment E=9.1e-27 PF00107: ADH_zinc_N" amino acids 180 to 307 (128 residues), 104 bits, see alignment E=9.1e-34 PF13602: ADH_zinc_N_2" amino acids 213 to 342 (130 residues), 76.8 bits, see alignment E=4.7e-25

Best Hits

KEGG orthology group: None (inferred from 54% identity to lch:Lcho_2743)

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF4355 Alcohol dehydrogenase (EC 1.1.1.1) (Variovorax sp. SCN45)
MKAAILQERGRNGLGVRNVPMPVRRPGEVLLSVHAAALNRVDLYMRDNGAGITHSLPQTL
GVEAAGVVVEADAGGGLEIGIQPGQKAVVYANAFCGKCRYCLAGDQPLCLHAHIMGEHRD
GGFAEYVAMPARCVLPLPDHVDLVEAGALLAAYLTAWRMLFGKRALRPGETVLIAGVGGG
VAVACLQLALHAGARVLVTSSSDDKLARAQAMGASGGVNYRREKVAKRVLEMTGGEGVDM
VIDSSGAASWDDSLRSLRRGGRLVTCGATTGSNPPADLQRIFIRQLEVYGSTGGSVAECH
QLLALFASGAIRPVIDRRFVLDDIGAAFDQLEHGNQFGKVVVTMA