Protein Info for GFF4351 in Xanthobacter sp. DMC5

Annotation: Multidrug resistance protein MdtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 48 to 368 (321 residues), 242.5 bits, see alignment E=2.8e-76 PF25917: BSH_RND" amino acids 74 to 209 (136 residues), 29 bits, see alignment E=1.6e-10 PF25876: HH_MFP_RND" amino acids 113 to 181 (69 residues), 24.9 bits, see alignment E=4.1e-09 PF25954: Beta-barrel_RND_2" amino acids 222 to 288 (67 residues), 42 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: None (inferred from 85% identity to xau:Xaut_0827)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>GFF4351 Multidrug resistance protein MdtE (Xanthobacter sp. DMC5)
VRDHRVNRGQDAGVVKGKHMLLGVLGACFFLSACGEAQKPQAQEPRPVRTVVATNRAASD
AVSLTGVVEAQNEATYGFRISGRVIDRLVNVGDRVAPGQVLARLDPQDEQNALRSAQAAL
GAANANLTQTRNQYERQRQLLARGFTPRAQYEQAEQAFLNARAQVDDAEARLQMAEDRLG
FTELKADSAGVVTQRRAEPGEVVQAGQPVIEVARQDGRDAVFDVPAAMLSGLPGDPEVTV
ALATDPAVTATGRVREVAPQADPVTRTFRVRVGLTNPPEGLRLGTTVVGRVMVDRGPVVE
IPASALTRLNDKPAVWVVDPKTQTVALRTIEVLRFGPASVSVGEGLKPSEIVVTAGVQAL
HPGQKVRLLAAPAGASL