Protein Info for GFF4347 in Variovorax sp. SCN45

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 57 (18 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 221 to 250 (30 residues), see Phobius details amino acids 257 to 279 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 277 (266 residues), 116 bits, see alignment E=9.1e-38

Best Hits

KEGG orthology group: None (inferred from 52% identity to pna:Pnap_2713)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF4347 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Variovorax sp. SCN45)
MDFSQAFNIAQLANALALASLLTILASGLALIFGLRDVMNFGHGALFMLGAYLGYTFSGL
FNFWAALVIVPLLLALLGVLFEYAAIRPLQRRSHMDVALVTFGLALILSQVVIKVWGTAP
LSVSAPPSLAGSLDLFGHAYPAYRIFLIAMGFGTCVLLAAWLKWTRSGMHVRAVSQQPMV
ARMMGVNTDRLSLLVVCLGTGFAGLAGVLAGPYLSVDPAMGASILISCLIVVVIGGLGSI
GGAIAAAVVFGLIQVIGALISPTLAVMAPYMLLFIVLLWRPQGLGRGRVA