Protein Info for GFF4342 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Heme O synthase, protoheme IX farnesyltransferase (EC 2.5.1.-) COX10-CtaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 208 to 227 (20 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 3 to 281 (279 residues), 308.3 bits, see alignment E=3.4e-96 PF01040: UbiA" amino acids 18 to 264 (247 residues), 216.8 bits, see alignment E=1.6e-68

Best Hits

Swiss-Prot: 100% identical to CYOE_SALCH: Protoheme IX farnesyltransferase (cyoE) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to sew:SeSA_A0497)

MetaCyc: 96% identical to heme O synthase (Escherichia coli K-12 substr. MG1655)
HEMEOSYN-RXN [EC: 2.5.1.141]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.141

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>GFF4342 Heme O synthase, protoheme IX farnesyltransferase (EC 2.5.1.-) COX10-CtaB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFKQYLQVTKPGIIFGNLISVIGGFLLASKGSIDYPLFIYTLVGVSLVVASGCVFNNYID
RDIDRKMERTKNRVLVKGLISPGVSLVYATLLGIAGFMLLWFGANPLACWLGVMGFVVYV
GVYSLYMKRHSVYGTLIGSLSGAAPPVIGYCAVTGDFDSGAAILLAIFSLWQMPHSYAIA
IFRFKDYQAANIPVLPVVKGISVAKNHITLYIIAFAVATLMLTLGGYAGYKYLVVAAAVS
VWWLGMALRGYKVEDDKVWARKLFGFSIIAITALSIMMSVDFMVPNSQNLLTYVW