Protein Info for GFF4334 in Pseudomonas sp. DMC3
Annotation: Methionine aminotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to YBDL_ECOLI: Methionine aminotransferase (ybdL) from Escherichia coli (strain K12)
KEGG orthology group: K14287, methionine aminotransferase [EC: 2.6.1.-] (inferred from 94% identity to pfo:Pfl01_4596)MetaCyc: 55% identical to methionine transaminase (Escherichia coli K-12 substr. MG1655)
R15-RXN [EC: 2.6.1.88]
Predicted SEED Role
"Methionine aminotransferase, PLP-dependent / Glutamine-dependent 2-keto-4-methylthiobutyrate transaminase" in subsystem Methionine Salvage
MetaCyc Pathways
- ethene biosynthesis III (microbes) (6/7 steps found)
- dimethylsulfoniopropanoate biosynthesis III (algae and phytoplankton) (1/4 steps found)
- L-homomethionine biosynthesis (2/7 steps found)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Arginine and proline metabolism
- Caprolactam degradation
- Lysine biosynthesis
- Lysine degradation
- Methionine metabolism
- Nucleotide sugars metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.-
Use Curated BLAST to search for 2.6.1.- or 2.6.1.88
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (382 amino acids)
>GFF4334 Methionine aminotransferase (Pseudomonas sp. DMC3) MITSKLPNVGITIFTQMSQLAAQTGAINLSQGFPDFDGPQSLRDAVGRHIASGHNQYSPM TGLPALRQQIAAKITRSYGVTVDADHEVTVTPGATQAIFCAIQAVIHSGDEVIVFDPCYD SYAPATELAGGRCLHVQLNPDDFSIDFDQLAAALSPRTKMIVINTPHNPSGALISRAELD QLAALIRDRDIYLISDEVYEHLVFDGVPHVSVLAHEELYQRAFVVSSFGKTYHVTGWKTG YVVAPPALTAELRKVHQYVSFCGVTPLQYALADYMAEHPEHVEELPGFYQAKRDLFCDLL APSRFSFTRVTGTYFQLVDYSQIRPDLNDVEMAMWMTREHGVASIPVSVFYQHPPQGQRL IRLCFAKREETLREAAAKLCVI