Protein Info for GFF4334 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 TIGR01422: phosphonoacetaldehyde hydrolase" amino acids 3 to 257 (255 residues), 382.5 bits, see alignment E=7.9e-119 PF00702: Hydrolase" amino acids 4 to 198 (195 residues), 57.3 bits, see alignment E=1.5e-19 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 34 to 203 (170 residues), 62.1 bits, see alignment E=7.2e-21

Best Hits

Swiss-Prot: 100% identical to PHNX_SALTY: Phosphonoacetaldehyde hydrolase (phnX) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05306, phosphonoacetaldehyde hydrolase [EC: 3.11.1.1] (inferred from 98% identity to stt:t2431)

MetaCyc: 65% identical to phosphonoacetaldehyde hydrolase (Vibrio splendidus)
Phosphonoacetaldehyde hydrolase. [EC: 3.11.1.1]

Predicted SEED Role

"Phosphonoacetaldehyde hydrolase (EC 3.11.1.1)" in subsystem Phosphonate metabolism (EC 3.11.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.11.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF4334 Phosphonoacetaldehyde hydrolase (EC 3.11.1.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNRIHAVILDWAGTTVDFGSFAPTQIFVEAFRQAFDVEITLAEARVPMGLGKWQHIEALG
KLPAVDARWQAKFGRSMSAADIDAIYAAFMPLQIAKVVDFSSPIAGVIDTIAALRAEGIK
IGSCSGYPRAVMERLVPAAAGHGYRPDHWVATDDLAAGGRPGPWMALQNVIALGIDAVAH
CVKVDDAAPGISEGLNAGMWTVGLAVSGNEFGATWDAYQTMSKEDVAVRREHAASKLYAA
GAHYVVDSLADLPGVIAHINARLAQGERP