Protein Info for GFF4332 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-aminoethylphosphonate uptake and metabolism regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 TIGR03337: phosphonate utilization transcriptional regulator PhnR" amino acids 9 to 239 (231 residues), 411.7 bits, see alignment E=4.5e-128 PF00392: GntR" amino acids 11 to 73 (63 residues), 69.4 bits, see alignment E=1.7e-23 PF07702: UTRA" amino acids 94 to 232 (139 residues), 129.5 bits, see alignment E=8.4e-42

Best Hits

Swiss-Prot: 100% identical to PHNR_SALTI: Putative transcriptional regulator of 2-aminoethylphosphonate degradation operons (phnR) from Salmonella typhi

KEGG orthology group: None (inferred from 99% identity to sei:SPC_0442)

Predicted SEED Role

"2-aminoethylphosphonate uptake and metabolism regulator" in subsystem Phosphonate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF4332 2-aminoethylphosphonate uptake and metabolism regulator (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKSIPGDIPQYLLIKAQLQARIQSGALKSGDKLPSERELCAIFNTTRITIRESLAQLESS
GLIWRADRRGWFVTPERLWLDPTQNTNFHKLCREQGREPKTALLSGVLTTVPVEVMEPLQ
LQPFDQIYLLTRLRYADGRAVCYCENHCLPARVPELLQYDLNGSLTEVYESHYNLVYTSM
HLSFYPTAMPAQAAQALGVMEGRPALLLRRLNYDQHGRVLDLDIEYWRHDSLRIEVDTH