Protein Info for GFF4331 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2-aminoethylphosphonate ABC transporter periplasmic binding component (TC 3.A.1.9.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03227: 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate binding protein" amino acids 1 to 332 (332 residues), 594.9 bits, see alignment E=2.4e-183 PF01547: SBP_bac_1" amino acids 37 to 276 (240 residues), 95.1 bits, see alignment E=1.7e-30 PF13416: SBP_bac_8" amino acids 45 to 303 (259 residues), 86.4 bits, see alignment E=6e-28 PF13531: SBP_bac_11" amino acids 46 to 277 (232 residues), 58.7 bits, see alignment E=1.6e-19 PF13343: SBP_bac_6" amino acids 77 to 317 (241 residues), 79.4 bits, see alignment E=6.1e-26

Best Hits

Swiss-Prot: 100% identical to PHNS_SALTY: Putative 2-aminoethylphosphonate-binding periplasmic protein (phnS) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11081, 2-aminoethylphosphonate transport system substrate-binding protein (inferred from 99% identity to see:SNSL254_A0476)

Predicted SEED Role

"2-aminoethylphosphonate ABC transporter periplasmic binding component (TC 3.A.1.9.1)" in subsystem Phosphonate metabolism (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>GFF4331 2-aminoethylphosphonate ABC transporter periplasmic binding component (TC 3.A.1.9.1) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLSRLALLSVFALASAPSWAESVVTVYSIDGLHDGDNSWYQVQFDAFTKATGITVRYVE
GGGGVVVERLAKERTNPQADVLVTAPPFIQRAAAEKLLANFNTDTASAIPDANNLYSPLV
KNYLSFIYNSKLLKTAPASWQDLLDGKFKNKLQYSTPGQAADGTAVMLQAFHSFGSKDAG
FAYLGKLQANNVGPSASTGKLTALVNKGEIYVANGDLQMNLAQMERNPNVKIFWPANDKG
ERSALAIPYVIGLVQGAPQSENGKKLINFLLSKEAQTRVSELSWGMPVRSDVTPSDEHYK
AATAALEGVQSWQPNWDDVAVSLSADISRWHKVTESE