Protein Info for PS417_02210 in Pseudomonas simiae WCS417

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 897 PF13185: GAF_2" amino acids 192 to 331 (140 residues), 36.7 bits, see alignment E=2.1e-12 PF01590: GAF" amino acids 193 to 331 (139 residues), 61.9 bits, see alignment E=4.4e-20 PF13188: PAS_8" amino acids 345 to 395 (51 residues), 22.4 bits, see alignment 4e-08 TIGR00229: PAS domain S-box protein" amino acids 345 to 464 (120 residues), 50.3 bits, see alignment E=2.6e-17 PF00989: PAS" amino acids 346 to 455 (110 residues), 30.6 bits, see alignment E=1.3e-10 PF08448: PAS_4" amino acids 351 to 459 (109 residues), 28.6 bits, see alignment E=6.5e-10 PF13426: PAS_9" amino acids 355 to 457 (103 residues), 54.1 bits, see alignment E=7.4e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 465 to 626 (162 residues), 117.4 bits, see alignment E=5.2e-38 PF00990: GGDEF" amino acids 469 to 622 (154 residues), 134.5 bits, see alignment E=1.4e-42 PF00563: EAL" amino acids 643 to 878 (236 residues), 258.2 bits, see alignment E=2.9e-80

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU0458)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U184 at UniProt or InterPro

Protein Sequence (897 amino acids)

>PS417_02210 diguanylate cyclase (Pseudomonas simiae WCS417)
MKSQPDVARMAAEVVTQLPVPSRLGMLRFERLNEASWALLYLDPNCERQFGLSAVELCAL
IGTPYASLMEPQARYQLHDTIQQQLTQSPHYLVRYTLHTSDGPLSLLEMGEAYKQHNRHL
LRGYLMVVDGLFSEIPTAAPTADLENQNSRLQIALELNQRAQQEQLQHLERVRAQQELIL
LLARQRYTTPNSLQEAAELITRSACDIYQIDCASIWNLEGQRLVPISAYHRADGQHHLPE
SIDASCFPDYLEALHSSRAIDATNAMRDPRTREMADSLRDKDIHAMLDASIRVDGHVVGV
LCLEQSGSTRAWQADEIAFAGELADQFAQVINNHNRRTATSALHLFQRAVEQSANAFLLV
NCDGVVEYVNPSFTAITQYSAEEVHGHRLAQLPALENLSELLFDAPSSLAKSNSWQGEFK
SRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDITQTKLAQQRIERLAYTDNLTNLGNR
PAFIRNLDERFARDSDSPISLLLVDIDNFKRINDSLGHQTGDKLLISLARRLRNSLSTGG
SLARFASNEFAVLLDDTDLESGQQVASQLLATLDKPMFVDNQLISVTGSVGLACAPLHGR
DPQTLMRNAGLALHKAKANGKHQVQVFTEALNAEASYKLFVENNLRRALTQNELDVFYQP
KLCLRSGRLLGMEALLRWNHPEKGMIRPDQFISVAEETGLIIPIGKWIARQACRMSKQLS
ASGMGNLQVAINLSPKQFSDPDLVASIASILKEEQLPANLLELELTEGLLLEATEDTRLQ
LDQLKSLGLTLAMDDFGTGYSSLSYLKKFPIDIIKIDRSFIHEIPDNQDDMEITSAVIAM
AHNLKLKVVAEGIETAEQLAFLRRHRCDVGQGYLFDRPIPGAELLAMLKRYPRGPIA