Protein Info for GFF4326 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 175 to 202 (28 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF02915: Rubrerythrin" amino acids 18 to 153 (136 residues), 97.5 bits, see alignment E=9.1e-32 PF01988: VIT1" amino acids 242 to 323 (82 residues), 35.2 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_2011)

Predicted SEED Role

"Hypothetical transmembrane iron-regulated protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>GFF4326 hypothetical protein (Xanthobacter sp. DMC5)
MLSFLSGRRRFADLSEREVLALAVSSEEDDARIYMEYAEALRSEYPDTAKVFESMAAQER
GHQTSLTREYERRYGGTVPLIRRESIAGYYGRRPVWAVVNLGIERIRAEVGRMEDEAANF
YLKAQQKTSDPGTRKLLESLYQTELQHEEIAGNLADRYLPADKKKEEDEKARRQFLLTFV
QPGLAGLMDGSVSTLAPIFATAFATQNSHTTLLVGLAAAVGAGISMGFTEALHDDGVISG
RGSPLKRGLSSGIMTAVGGLGHALPYIIPEFWTATAIAIIVVFIELWAIAFIQNRYMETP
FWRSVFQIVLGGALVLAAGIFIGGS