Protein Info for GFF4326 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01280: exodeoxyribonuclease VII, small subunit
  • amino acids 10 to 65 (56 residues), 84.1 bits, E=2.7e-28
• PF02609: Exonuc_VII_S
  • amino acids 11 to 62 (52 residues), 76.6 bits, E=6e-26

Best Hits

Swiss-Prot: 100% identical to EX7S_SALDC: Exodeoxyribonuclease 7 small subunit (xseB) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: K03602, exodeoxyribonuclease VII small subunit [EC: 3.1.11.6] (inferred from 100% identity to sec:SC0465)

MetaCyc: 90% identical to exodeoxyribonuclease VII subunit XseB (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII small subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Protein Sequence (80 amino acids)

>GFF4326 Exodeoxyribonuclease VII small subunit (EC 3.1.11.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPKKNEAPASFETALSELEHIVTRLESGDLPLEDALNEFERGVQLARQGQAKLQQAEQRV
QILLSDNEEASPEPFIADNE