Protein Info for PS417_22150 in Pseudomonas simiae WCS417

Updated annotation (from data): D-mannose isomerase (EC 5.3.1.7)
Rationale: Specifically important for: D-Mannose. D-mannose isomerase is the first step in mannose catabolism. This gene is similar to the putative mannose isomerase Sama_0560 (PMID:20836887, PMCID: PMC4436071).
Original annotation: sugar isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 119 to 134 (16 residues), see Phobius details PF07221: GlcNAc_2-epim" amino acids 40 to 394 (355 residues), 413.7 bits, see alignment E=3.4e-128

Best Hits

KEGG orthology group: None (inferred from 93% identity to pfs:PFLU4847)

Predicted SEED Role

"N-acylglucosamine 2-epimerase (EC 5.1.3.8)" in subsystem Sialic Acid Metabolism (EC 5.1.3.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.8 or 5.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UE67 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PS417_22150 D-mannose isomerase (EC 5.3.1.7) (Pseudomonas simiae WCS417)
MITQPLPASSWLNAPAHYVWLAAEGQRLLAFAKASRLPDGFGNLDDKGQLPADAHAETMN
TARMTHSFAMAHALGLPGYAELVAHGVAALSGALRDSEHGGWFAAPHALDGNRGKAAYLH
AFVALAASSAVVAGAPGASTLLNDAIHIIDHFFWSEEEGVMLESFAQDWSGVEAYRGANS
NMHATEAFLALADVTGDTRWLDRALRIVERVIHTHAAGNQFMVIEHFDTHWHPLLGYNED
NPADGFRPYGITPGHGFEWARLVLHLEAARLQAGLVTPEWLVADAKRLFASACEYAWSVD
GAPGIVYTLDWNHRPVVRERLHWTHAEASAAAQALLKRTGELHYETWYRRFWEFCETHFI
DRLHGSWHHELSPHNQPSSNIWGGKPDLYHAWQAVLLPALPLAPSMASAIGTGRYVTNW