Protein Info for PS417_22135 in Pseudomonas simiae WCS417

Updated annotation (from data): glucose/xylose ABC transporter, permease component 1
Rationale: Specifically important for utilization of D-glucose 6-phosphate and D-xylose. Glucokinase (PS417_22685) is important for glucose-6-phosphate utilization, which implies that it is hydrolyzed to glucose before uptake.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 143 to 165 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 100 to 266 (167 residues), 51 bits, see alignment E=7.6e-18

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to pfo:Pfl01_4368)

Predicted SEED Role

"Glucose ABC transport system, inner membrane component 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGI3 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PS417_22135 glucose/xylose ABC transporter, permease component 1 (Pseudomonas simiae WCS417)
MTSLASKPAISLSRIAIYAVLILAVLLYLVPLVVMLLTSFKTPEDISSGNLLSWPTVVTG
IGWVKAWATVDGYFWNSIKITVPAVLISTAIGALNGYVLSFWRFKGSQLFFGLLLFGCFL
PFQTVLLPASFTLGKMGLASTTTGLVFVHVVYGLAFTTLFFRNYYVSIPDALIKAARLDG
AGFFTIFRQIILPMSTPIIMVCLIWQFTQIWNDFLFGVVFSSGDSQPITVALNNLVNTST
GAKEYNVDMAAAMIAGLPTLLVYVIAGKYFVRGLTAGAVKG