Protein Info for PS417_22125 in Pseudomonas simiae WCS417

Annotation: porin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF04966: OprB" amino acids 77 to 448 (372 residues), 384.9 bits, see alignment E=2.8e-119

Best Hits

Swiss-Prot: 64% identical to PORB_PSEAE: Porin B (oprB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07267, porin (inferred from 96% identity to pfs:PFLU4842)

Predicted SEED Role

"Glucose-selective porin OprB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQR7 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_22125 porin (Pseudomonas simiae WCS417)
MKKQHNNTRLICQMSAAAALVLSANAMAADAFSADSKWMTGDWGGERTKLIEQGIDIKAD
YVGEMGYNAKGGYNDDKTGRYSDQFGLGVALDLQKLWGWDNTQAKIQLTNRNGQNISNDR
IGDPRAGTLSSSMEVYGRGHMVRLTQFWIQHQMFDNKLDVKLGYFGEGEDFNTFPCDFQN
LSFCGSQVGNYVNTWYNWPVSQAAIRVKYNITPELYAQIGAYNQNPSQLEHGNGFKLSGS
GTKGTVIPVELVWSPKVNNLPGEYRVGYYKSAADAPDVREDVNGNDAVITRADFRTRSSK
KGYWFVAQQQLTTHNGDASRGLNIAANATFHDKETNLVDNYQSLMLVYKGPFDARPKDDV
GIGVARLHVNNDVKKNAELLNAANGVSDYDNALYTPIRETEYNVELNYGFHVTNWLTVRP
NLQYVVQPGGVDKVDNALVAGLKIQSTF