Protein Info for PS417_02205 in Pseudomonas simiae WCS417

Annotation: peptide methionine sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 42 to 61 (20 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 52 to 204 (153 residues), 212.4 bits, see alignment E=2.1e-67 PF01625: PMSR" amino acids 52 to 204 (153 residues), 203 bits, see alignment E=1.6e-64

Best Hits

Swiss-Prot: 85% identical to MSRA_PSESM: Peptide methionine sulfoxide reductase MsrA (msrA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 97% identity to pfs:PFLU0457)

MetaCyc: 58% identical to methionine sulfoxide reductase A (Escherichia coli K-12 substr. MG1655)
L-methionine (S)-S-oxide reductase. [EC: 1.8.4.13]; Peptide-methionine (S)-S-oxide reductase. [EC: 1.8.4.13, 1.8.4.11]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TVL8 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PS417_02205 peptide methionine sulfoxide reductase (Pseudomonas simiae WCS417)
MVLRSEILVNKNVLPTQEQALPGRETPMSLPETHFVNGNPLLGPFLDDVGFAIFGLGCFW
GAERRFWQRDGVVSTVVGYAGGYTPNPTYEEVCSGLTGHSEVVLVVYDQDKVKYEDLLKM
FWELHNPTQGMRQGNDIGSQYRSVIYATTPEQLAAAKASAEAYQGELTKAGLGAITTEIE
EAPTVYFAEAYHQQYLAKNPQGYCGIGGTGVSCPI