Protein Info for GFF4317 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ribonucleotide reductase transcriptional regulator NrdR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 TIGR00244: transcriptional regulator NrdR" amino acids 1 to 123 (123 residues), 212.3 bits, see alignment E=1.5e-67 PF03477: ATP-cone" amino acids 26 to 112 (87 residues), 74.1 bits, see alignment E=5.6e-25

Best Hits

Swiss-Prot: 100% identical to NRDR_SALPA: Transcriptional repressor NrdR (nrdR) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K07738, transcriptional repressor NrdR (inferred from 95% identity to eco:b0413)

Predicted SEED Role

"Ribonucleotide reductase transcriptional regulator NrdR" in subsystem Ribonucleotide reduction

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (125 amino acids)

>GFF4317 Ribonucleotide reductase transcriptional regulator NrdR (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VRRRRQCLVCNERFTTFEVAELVMPRVIKSNDVREPFNEDKLRSGMLRALEKRPVSADDV
EMALNHIKSQLRATGEREVPSKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKDFGEEI
ARLQD