Protein Info for GFF4316 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 123 to 142 (20 residues), see Phobius details amino acids 162 to 187 (26 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 255 to 283 (29 residues), see Phobius details amino acids 295 to 319 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 43 to 308 (266 residues), 152.4 bits, see alignment E=2.2e-48 PF00005: ABC_tran" amino acids 363 to 521 (159 residues), 93.3 bits, see alignment E=3.1e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (600 amino acids)

>GFF4316 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MNTTTSPLLATAPPVRPWAGRLGTVAAVLAALSLPLWFRGDFILFMATQAGVMMLVAIGL
NLLTGYAGQVSLGHGALVAVGSYTTALLMIDAHWSFWLAALAGMAVSTLAGLVMALPALR
LSTWYFALVTLTFAQVVTDLLVEWRSLTRGFSGLVGIPPPAIGAHVLGPVEVYLAVAACV
VLAFLGVRNLSRSRYGRGMVAARDNPLAATASGVSLLRIKLFAFAVSAALAGLAGAFYAV
QKTVITPEDFTADFSIFFLLIIVVGGLGRLWGPVVGTLVFFLLPELLGPLQSWRLLIYGV
VLLVLMVFAPHGIMGMPVWQRWRKRPVASDAPAPGARAQPVQRLSLAVQDLHKQFGGVAA
LQGCALVAEAGSTHALVGPNGSGKTTTLNVISGFIRSDSGAVLIGGTDVSGRAPHRIARL
GVGRTFQTPKLLHDLSVRDNVRLGGFASERASAFEILFGLPRARQDQRDGSAAAMTLLRF
VGLAERADDLAGDLPHGQQRLVEIARAMAGRPSLLLLDEPAAGLSMDELDRLGALIEAIA
ALGTTVLVVEHHLELIARISRSVTVLDRGRVLTAGTPQQVFSHPEVERAYMGREGTGGAR