Protein Info for GFF4315 in Xanthobacter sp. DMC5

Annotation: Large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 79 to 103 (25 residues), see Phobius details PF01741: MscL" amino acids 3 to 135 (133 residues), 148.8 bits, see alignment E=5e-48 TIGR00220: large conductance mechanosensitive channel protein" amino acids 3 to 136 (134 residues), 131 bits, see alignment E=1.5e-42

Best Hits

Swiss-Prot: 70% identical to MSCL_OLICO: Large-conductance mechanosensitive channel (mscL) from Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 79% identity to xau:Xaut_0055)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (156 amino acids)

>GFF4315 Large-conductance mechanosensitive channel (Xanthobacter sp. DMC5)
MPILKEFKEFAVRGNVVDLAVGVIIGAAFGNIVTSLVGDVFMPIIGAVTGGLDFSNYFVP
LSKSVTAANLADAKKQGAVLAYGSFITIAINFIIVAGVLFLVVRGINALRRAEAGKPPAA
PTKTEVLLMEIRDLLASERPAPRPPVTPAPPAPPTA