Protein Info for GFF4313 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nucleoside-specific channel-forming protein Tsx precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03502: Channel_Tsx
  • amino acids 32 to 287 (256 residues), 279.5 bits, E=1.4e-87

Best Hits

Swiss-Prot: 100% identical to TSX_SALTI: Nucleoside-specific channel-forming protein Tsx (tsx) from Salmonella typhi

KEGG orthology group: K05517, nucleoside-specific channel-forming protein (inferred from 100% identity to sei:SPC_0424)

MetaCyc: 81% identical to nucleoside-specific channel-forming protein Tsx (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-468

Predicted SEED Role

"Nucleoside-specific channel-forming protein Tsx precursor"

Protein Sequence (287 amino acids)

>GFF4313 Nucleoside-specific channel-forming protein Tsx precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGSYHTRFSPKLNNDVYLE
YEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFMEIEPRFSIDKLTGADLSFG
PFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPMGLSLNVYAKYQWQNYGASNE
NEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDLGDDPNRTSNSIASSHILALNYD
HWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTGWGGYLVVGYNF