Protein Info for GFF431 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2,3-diketo-L-gulonate TRAP transporter large permease protein yiaN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 27 to 28 (2 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 93 to 123 (31 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 240 to 257 (18 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 314 to 343 (30 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 396 to 418 (23 residues), see Phobius details PF06808: DctM" amino acids 7 to 416 (410 residues), 475 bits, see alignment E=2e-146 TIGR00786: TRAP transporter, DctM subunit" amino acids 17 to 418 (402 residues), 512 bits, see alignment E=5.2e-158

Best Hits

Swiss-Prot: 91% identical to YIAN_ECOLI: 2,3-diketo-L-gulonate TRAP transporter large permease protein YiaN (yiaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to stt:t3847)

MetaCyc: 91% identical to 2,3-diketo-L-gulonate:Na+ symporter - membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"2,3-diketo-L-gulonate TRAP transporter large permease protein yiaN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>GFF431 2,3-diketo-L-gulonate TRAP transporter large permease protein yiaN (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAVVIFLCCLLGGIAIGLPIAWSLLLCGAALMAYLDMFDVQIMAQTLVNGADSFSLLAIP
FFVLAGEIMNAGGLSKRIVDLPMKLVGHKPGGLGYVGVIAAMIMASLSGSAVADTAAVAA
LLVPMMRSANYPINRSVGLIASGGIIAPIIPPSIPFIIFGVSSGLSISKLFMAGIAPGIM
MGAALMLTWWWQAGRLNLPSQPKATPREIWQSLVSGIWALFLPVIIIGGFRSGLFTPTEA
GAVAAFYALFVAVVIYRELTFSSLYHVLVNAAKTTSVVMFLVAAAQVSAWLITIAELPMM
VSDLLQPLVDSPRLLFIVIMISIMVVGMVMDLTPTVLILTPVLLPLVKEANIDPIYFGVM
FIINCSIGLITPPVGNVLNVISGVAKLKFDDAVRGVFPYVVVLMSLLVLFIFIPELIITP
LKWIN