Protein Info for GFF4308 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG000988: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 52 to 76 (25 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 3 to 346 (344 residues), 366.1 bits, see alignment E=6.8e-114 PF03739: LptF_LptG" amino acids 7 to 347 (341 residues), 182.2 bits, see alignment E=8e-58

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 60% identity to pol:Bpro_2407)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>GFF4308 FIG000988: Predicted permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLFHSSIRKELARSFGATLVVLFTIVLTMLLIRTLGLASRGSVDPQEIALVLGYTVIGRM
PTILTLALFIAIVFTLSRMYRDSEMIIWFSSGRSLGGFLRPVMRFSWPILVVITVMVFFV
WPWANAQTDQLRDRFERRGDLERVAPGQFQESSSGRRVFFIDKDTADGTEGRNIFISSTE
NDGRETVTSARSGRIEWLNEQQFLMLNNGQRLETPADQSNLKVSEFEEYGTQIGVSAISQ
RGEALKARTSWDLIRDPTRANLGELGWRIGMALTALNFVLIAVATTTGNPRAGRGGNLFF
TLFAFVFYYNLLNLGQSWVASGLFSLGGYMVGLHGGVFVVTVLWFFKRHHNLSLRGLLSA
RRAQRSATAGAGA