Protein Info for GFF4307 in Sphingobium sp. HT1-2

Annotation: Conjugative signal peptidase TrhF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 24 to 41 (18 residues), see Phobius details PF10502: Peptidase_S26" amino acids 23 to 178 (156 residues), 53.1 bits, see alignment E=2e-18

Best Hits

KEGG orthology group: K12062, conjugal transfer pilin signal peptidase TrbI (inferred from 56% identity to swi:Swit_5374)

Predicted SEED Role

"Conjugative signal peptidase TrhF" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>GFF4307 Conjugative signal peptidase TrhF (Sphingobium sp. HT1-2)
VSGAAGEGDPLARKALIARRVRQWSAVALLASAWAGYNALGAWQQSHAFMINASESLPNW
AFFVARGKTPAKGDYVFFVPPDNALVRRHFGPETGPFGKRVIGMAGSLVEHRGAYVYVDG
VRVAHMKPLTRTGEPLTPGPVGRVPEGCYYVGTPHPDGFDSRYAEIGFACAKQLVGTGTP
IL