Protein Info for PS417_22030 in Pseudomonas simiae WCS417

Annotation: glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF02798: GST_N" amino acids 2 to 74 (73 residues), 35 bits, see alignment E=4.3e-12 PF13409: GST_N_2" amino acids 10 to 75 (66 residues), 40.3 bits, see alignment E=1.2e-13 PF13417: GST_N_3" amino acids 15 to 78 (64 residues), 32.3 bits, see alignment E=3e-11 PF13410: GST_C_2" amino acids 121 to 181 (61 residues), 27.3 bits, see alignment E=9.9e-10 PF14497: GST_C_3" amino acids 124 to 194 (71 residues), 26 bits, see alignment E=2.6e-09 PF00043: GST_C" amino acids 129 to 189 (61 residues), 28.7 bits, see alignment E=3.8e-10

Best Hits

Swiss-Prot: 40% identical to GST_OCHAN: Glutathione S-transferase (gst) from Ochrobactrum anthropi

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 89% identity to pfs:PFLU4821)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UGG6 at UniProt or InterPro

Protein Sequence (202 amino acids)

>PS417_22030 glutathione S-transferase (Pseudomonas simiae WCS417)
MKLYFFPHACSLAPHIVLRELAIPFDLVLVDNQAKTTAEGEDFLQINPKGYVAALKLDNG
QVLTEASAILQYLADLKPTANLAPANGSWERVRLQEWLNFIATEVHGGLAVFFNGVIQGE
VRAMFQATLFKRFAVLVQMLERQDYLLGAQYSVADAYLFVVLRWAALHAIDLREWPALAA
FEQRVGQRPAVIAALAAESPKS