Protein Info for GFF430 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: 2,3-diketo-L-gulonate-binding periplasmic protein yiaO precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03480: DctP
  • amino acids 30 to 312 (283 residues), 360.5 bits, E=3.4e-112
• TIGR00787: TRAP transporter solute receptor, DctP family
  • amino acids 30 to 285 (256 residues), 365.4 bits, E=7.6e-114

Best Hits

Swiss-Prot: 88% identical to YIAO_ECOLI: 2,3-diketo-L-gulonate-binding periplasmic protein YiaO (yiaO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to seh:SeHA_C3996)

MetaCyc: 88% identical to 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"2,3-diketo-L-gulonate-binding periplasmic protein yiaO precursor"

Protein Sequence (328 amino acids)

>GFF430 2,3-diketo-L-gulonate-binding periplasmic protein yiaO precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKLHVIARSLLIAGLTVFSVSSLAAQSLRFGYETPQTDSQHIAAKKFNELLKEKTNGELT
LKLFPDSTLGNAQAMISGVRGGTIDMEMSGSNNFTGLAPVFNLLDVPFLFRDTAHAHKTL
DGKVGDELKKSLDSKGLKVLAYWENGWRDVTNSRAPVKTPGDLKGLKIRTNNSPMNIAAF
KIFGANPIPMPFSEVYTGLETRTIDAQEHPINVVWSAKFYEVQKYLSLTHHAYSPLLLVI
NKAKFDALSPQFQEALLSSAKEAGDYQRKLVAEDQQKIIDGMKEAEVEVLTDIDRKAFSD
ALGSQVRDMFLKDNPQGADLLKAVDEVQ