Protein Info for GFF43 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01853: UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD
  • amino acids 8 to 329 (322 residues), 431.3 bits, E=1e-133
• PF04613: LpxD
  • amino acids 22 to 88 (67 residues), 76.2 bits, E=3.7e-25
• PF00132: Hexapep
  • amino acids 110 to 144 (35 residues), 37.7 bits, 2.8e-13
  • amino acids 145 to 179 (35 residues), 36.4 bits, 7.3e-13
  • amino acids 222 to 255 (34 residues), 30.3 bits, 5.9e-11
• PF14602: Hexapep_2
  • amino acids 111 to 143 (33 residues), 31.1 bits, 4e-11

Best Hits

Swiss-Prot: 100% identical to LPXD_SALPA: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (lpxD) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02536, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [EC: 2.3.1.-] (inferred from 99% identity to ses:SARI_02776)

MetaCyc: 96% identical to UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Escherichia coli K-12 substr. MG1655)
UDPHYDROXYMYRGLUCOSAMNACETYLTRANS-RXN [EC: 2.3.1.191]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (23/25 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.191

Protein Sequence (341 amino acids)

>GFF43 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (EC 2.3.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPSIRLADLAEQLDAELHGDGDIVITGVASMQSATTGHITFMVNPKYREHLGLCQASAVV
MTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATATLGSNVSVGA
NAVIESGVQLGDNVVIGAGCFVGKNSKIGAGSRLWANVTIYHDIQIGENCLIQSSTVIGA
DGFGYANDRGNWVKIPQLGRVIIGDRVEIGACTTIDRGALDDTVIGNGVIIDNQCQIAHN
VVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGV
YSSGIPLQPNKVWRKTAALVMNIDDMSKRLKAIERKVNQQD