Protein Info for GFF4296 in Xanthobacter sp. DMC5

Annotation: Riboflavin transport system permease protein RibX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 229 to 247 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 254 (170 residues), 109.6 bits, see alignment E=7.8e-36

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 82% identity to azc:AZC_2352)

Predicted SEED Role

"Hydroxymethylpyrimidine ABC transporter, transmembrane component" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>GFF4296 Riboflavin transport system permease protein RibX (Xanthobacter sp. DMC5)
MASPRHRNPVLAVIDAPWARPVGLLVILIAIWDISVRIFQIPAYLIPTPWDVMIAFRNDG
AMLAREAVPTTIATLAGFALSAAIGIPLAMLIAGSRTIEAYLYPLLVFSQSIPKVAIAPL
FVVWFGFGIVPKVISAFLLGVFPVVVAGVQGFKSVEADMRDLARSMKASRLQTFAMVSLP
HAMPAIFAGLKVSVTLAVVGAVVGEFVGSNSGLGFVLQRSIGNFELPTMFAALIVLALIG
VVLFWVIDLVERLVVPWHASQRHDVFVTV