Protein Info for GFF4294 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putative sulfate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 30 to 54 (25 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 151 to 182 (32 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 244 to 262 (19 residues), see Phobius details PF01925: TauE" amino acids 6 to 260 (255 residues), 159.1 bits, see alignment E=7.6e-51

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 76% identity to rfr:Rfer_2455)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF4294 Putative sulfate permease (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPDIAIILAGFAVGLIVGLTGVGGGSLMTPILIFFFGVKPYLAVGTDLLFAAFTKMGGTV
NLARQKLVPWRVVGQLSAGSLPAALLTLLVLRQLGPTSAAVQSLMTNTLGVALLLTAVAM
LYKAARGKQLPRQLPEGQLDKATHARHWSLPVLFGAVIGMLVTLTSVGAGAIGVSVLLLL
FPLLPLPRIVAADIAYAVPLTLVAGLGHASLGSVDWPLLAKLLAGSLPGIWLGTRLMRHT
PERLVRSALSLLLAYAGTKLIAF