Protein Info for GFF4294 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Exonuclease SbcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR00619: exonuclease SbcCD, D subunit" amino acids 1 to 253 (253 residues), 298 bits, see alignment E=3.7e-93 PF00149: Metallophos" amino acids 1 to 225 (225 residues), 61.2 bits, see alignment E=2.8e-20 PF12320: SbcD_C" amino acids 276 to 372 (97 residues), 88.2 bits, see alignment E=5.8e-29

Best Hits

Swiss-Prot: 84% identical to SBCD_ECOLI: Nuclease SbcCD subunit D (sbcD) from Escherichia coli (strain K12)

KEGG orthology group: K03547, exonuclease SbcD (inferred from 99% identity to spt:SPA2327)

MetaCyc: 84% identical to ATP-dependent structure-specific DNA nuclease - SbcD subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Exonuclease SbcD" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF4294 Exonuclease SbcD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRILHTSDWHLGQNFYSKSRAAEHQAFLDWLLETAQAHQVDAIIVAGDIFDTGSPPSYAR
ELYNRFVVNLQQTGCHLVVLAGNHDSVATLNESRDILAFLNTTVIASAGYAPRLLHRRDG
SPGAVLCPIPFLRPRDIITSQAGLSGSEKQQQLLHAIADYYQQQYQEACQLRGERKLPVI
ATGHLTTVGASKSDAVRDIYIGTLDAFPAQHFPPADYIALGHIHRAQCVGGTEHIRYCGS
PIALSFDECGKSKCVHLVTFEQGKWQSTESLAVPVTQPLAVLKGDLASITEQLEQWRGVE
QSPPVWLDIEITTDDYLHDIQRRIQTLTESLPVEVLLVRRSREQRERSLANERRETLSEL
SVEEVFARRLALEALDPPQRERLNQLFSSTLYALNEEHEA