Protein Info for PS417_21985 in Pseudomonas simiae WCS417

Annotation: gluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01313: carbohydrate kinase, thermoresistant glucokinase family
  • amino acids 8 to 169 (162 residues), 202.7 bits, E=1.6e-64
• PF13671: AAA_33
  • amino acids 9 to 140 (132 residues), 38.5 bits, E=6.8e-14

Best Hits

KEGG orthology group: K00851, gluconokinase [EC: 2.7.1.12] (inferred from 98% identity to pfs:PFLU4811)

Predicted SEED Role

"Gluconokinase (EC 2.7.1.12)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.12)

MetaCyc Pathways

• D-gluconate degradation (1/1 steps found)
• sorbitol biosynthesis II (2/3 steps found)
• L-idonate degradation (1/3 steps found)
• ketogluconate metabolism (4/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.12

Sequence Analysis Tools

See A0A1N7U7Z7 at UniProt or InterPro

Protein Sequence (177 amino acids)

>PS417_21985 gluconokinase (Pseudomonas simiae WCS417)
MSQPVTALVIMGVSGCGKSSVSEALCRLNGATAIEGDSFHPAANIEKMSAGHPLNDDDRA
GWLDILCDELRRSLKAGEHPVLTCSALKKKYRDHLREAAPGLGFVFLELTRAVAADRVSH
RPGHFMPASLIDSQFATLESPKGEPLTLALNASEDSVEALAEQTHAWWLQHGFEPTH