Protein Info for GFF4292 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Protein AraJ precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 293 to 315 (23 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 354 to 375 (22 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 330 (323 residues), 138.5 bits, see alignment E=2.7e-44 PF00083: Sugar_tr" amino acids 41 to 177 (137 residues), 35.3 bits, see alignment E=6.4e-13

Best Hits

Swiss-Prot: 85% identical to ARAJ_ECOLI: Putative transporter AraJ (araJ) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 98% identity to see:SNSL254_A0437)

Predicted SEED Role

"Protein AraJ precursor" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>GFF4292 Protein AraJ precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKVIFSLALGTFGLGMAEFGIMGVLTELARDVGITIPAAGHMISFYAFGVVLGAPVMAL
FSSRFSLKHILLFLVMLCVMGNAIFTFSSSYLMLAVGRLVSGFPHGAFFGVGAIVLSKII
RPGKVTAAVAGMVSGMTVANLVGIPFGTYLSQEFSWRYTFLLIAVFNIAVLTAIFFWVPD
IRDKAQGSLREQFHFLRSPSPWLIFAATMFGNAGVFAWFSYIKPFMMYISGFSETSMTFI
MMLVGLGMVLGNLLSGKLSGRYTPLRIAVVTDLVIVLSLMALFFFSGYKTTSLTFAFICC
AGLFALSAPLQILLLQNAKGGELLGAAGGQIAFNLGSAIGAWCGGLMLTLGFAYHYVALP
AALLSFSAMSSLLVYGRLKHKQPSVTPVAG