Protein Info for GFF429 in Xanthobacter sp. DMC5

Annotation: Sialic acid-binding periplasmic protein SiaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 33 to 288 (256 residues), 208.7 bits, see alignment E=5.2e-66 PF03480: DctP" amino acids 33 to 300 (268 residues), 248.1 bits, see alignment E=6e-78

Best Hits

KEGG orthology group: None (inferred from 88% identity to azc:AZC_2416)

Predicted SEED Role

"TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>GFF429 Sialic acid-binding periplasmic protein SiaP (Xanthobacter sp. DMC5)
MIDRRRGLAAALALAAAFTLGGPASAQTKLKWAHVYEPSEPFHTASVWAAGEIAKRTNGR
YQIDVYPSSQLGKESDINQGLTLGTVDMIISGSSFAGKAYPPIGVTYYPYTFRDAGHLLA
YAKSDVFKDLAKGYEDKTGNHIVAVTYYGVRQSTSNKPFKTCAEMKGLKIRVPDAPAYLA
MPKACGANITPIAFAEVYLALQNGTVDAQENPLTTIEAKKFYEVQKNIVLTGHIVDHLNT
IISGSLWKKLSPEDQKIFTEVTQEAAAKATAEVAQREKELLDIFKQKGLTVVEVDTDDFR
NTVMKNITFESFGYRKADWDRIQAIKSNM