Protein Info for GFF4287 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Thioredoxin reductase (EC 1.8.1.9)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF07992: Pyr_redox_2" amino acids 14 to 301 (288 residues), 80.9 bits, see alignment E=2.3e-26 PF13738: Pyr_redox_3" amino acids 70 to 298 (229 residues), 68 bits, see alignment E=1.8e-22 PF13434: Lys_Orn_oxgnase" amino acids 89 to 202 (114 residues), 23.9 bits, see alignment E=4.5e-09

Best Hits

Swiss-Prot: 80% identical to FENR_POLSJ: Ferredoxin--NADP reductase (Bpro_2333) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 80% identity to pol:Bpro_2333)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>GFF4287 Thioredoxin reductase (EC 1.8.1.9) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTIANTPDGTIETDAVIVGAGPVGLFQVFELGLLEIQAHVIDALPYPGGQPAELYPDKPI
YDIPAIPVCTGQELVDRLLGQIKPFGASFHLGQEVSTVQPQEDGRFFVATSQGTQFLTRT
LFIAAGVGAFQPRKLQVEGLEAFEDTQLFYRVRNPADFAGKHLVIIGGGDSALDWALNFA
ADGPHRAASVILLHRRDGFQAAPASVARMRELCERQKMQFIVGQTTGFEASEGRLTGLKV
TGPDDVTRVVPLDALLVFFGLSPKLGPIADWGLDIERKQLVVDTEKFSTSIPGIFAVGDI
NTYPGKKKLILSGFHECALAAFGAAPFIFPDRKVTLQYTTSSTKLHKVLGVDSPTID