Protein Info for GFF4286 in Xanthobacter sp. DMC5

Annotation: Phytochrome-like protein cph1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 719 PF08446: PAS_2" amino acids 20 to 118 (99 residues), 53.3 bits, see alignment E=1.3e-17 PF01590: GAF" amino acids 144 to 306 (163 residues), 52.1 bits, see alignment E=3.1e-17 PF00360: PHY" amino acids 324 to 500 (177 residues), 169.4 bits, see alignment E=1.6e-53 PF07568: HisKA_2" amino acids 529 to 602 (74 residues), 75 bits, see alignment E=1.2e-24 PF13581: HATPase_c_2" amino acids 621 to 688 (68 residues), 29.4 bits, see alignment E=2.2e-10

Best Hits

KEGG orthology group: None (inferred from 71% identity to xau:Xaut_2444)

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (719 amino acids)

>GFF4286 Phytochrome-like protein cph1 (Xanthobacter sp. DMC5)
MKDASVSSTAPRTTPDLGACDREPIHIPGSIQPHGLLLVADSRTRTVVGGAGDIEGRLTE
DWLGATLDTLLGQDLSAQLREAPQSGVTRVGLVPGRAETFEVLLHRAPQGLLVELEPAPE
VRLGAAEVLAGLDAAAVSFERAPDLRNLCAEAASVFRRITGFDRVMIYQFLDDEAGTVLG
EAKAKEMGSFLNHHFPGSDIPRQARALYVRNRVRVIPDVAYEPAPLRPAEAGLAQLDLSD
VMLRSVSPIHIQYLHNMGVGASASVSIVKDGVLWGLVACHHRTPRRLPYELRMACQSLAA
NLARQIRTREEAMQYRDRIRLRGAEDSLADYLAADAPVEDVLARHGDDLRRALGADGFAV
VEADRVRTCGRCPDETALRRIARWVEGKAQTRAFSTRALPSLLPAAADVAPLASGVAAVN
IPGDAPLVLLWLRAEQVEVVNWAGNPHRDDPADPNAQLTPRASFEAWSETVRGKARAWSL
AEVETINRLGHAVLQARQNRRVRDLNRRLSATVVENEQLLQHKDFLMREVNHRVQNSLQL
VSSFLRLQSRRLGESEAASALAEAERRVAAVGLVHRQLYAGEQVEAVDLSRYLIDLTNEV
TSALGKEWEAHIMLDVAPVLMAADRAVRLGLILTELVLNTAKYAYGGAPGPLRVALEQHR
DRFRLIVADHGSGKVGERQGFGTLMIKAMVQGLDGVIADEENAPGLRTIVTAPLCPSGA