Protein Info for GFF4282 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Murein-DD-endopeptidase (EC 3.4.99.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF00768: Peptidase_S11" amino acids 135 to 359 (225 residues), 202.9 bits, see alignment E=5.8e-64 PF13354: Beta-lactamase2" amino acids 144 to 292 (149 residues), 42.7 bits, see alignment E=3.9e-15

Best Hits

KEGG orthology group: K07262, D-alanyl-D-alanine endopeptidase (penicillin-binding protein 7) [EC: 3.4.21.-] (inferred from 65% identity to adk:Alide2_3120)

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-, 3.4.99.-

Use Curated BLAST to search for 3.4.21.- or 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>GFF4282 Murein-DD-endopeptidase (EC 3.4.99.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MVIGVDRFRKILLVAAVAGWVALAFAPLQSQAATNAKTAKAAKKTVTVKAAPKRTVAASK
KVQPKVAQAPARKTARVASKPQERVKVQMAAGKTTSLHKVAVQRKPAASQAVMRAAVTPR
LSEGSRQGLRSMDDPLELNSSVALVVDQETNEVLFSKNDAAVLPIASLTKLMTGLVVADA
HLNMQEMITITQDDVDTFKGSSSRLAVGTTLSRGELMHLALMSSENRAAHALGRTYPGGL
SEFVRLMNRKALELGMADTRYVEPTGLSSSNQSSARDLATLVSAAYQRPILRDLSTSPSY
EVDLGRRTLHYNNSNGLIKNPSWDIGLQKTGYISEAGRCLVMQAKVAGRQLIMVFLDATG
KVGRMQDAERVRRWVEVQTDARAVVRPQG