Protein Info for GFF4282 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Protein YaiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 45 to 72 (28 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details PF05230: MASE2" amino acids 39 to 127 (89 residues), 101.6 bits, see alignment E=2e-33 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 205 to 369 (165 residues), 201.6 bits, see alignment E=3.6e-64 PF00990: GGDEF" amino acids 210 to 365 (156 residues), 153.3 bits, see alignment E=4.9e-49

Best Hits

Swiss-Prot: 75% identical to DGCC_ECOLI: Probable diguanylate cyclase DgcC (dgcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to stt:t2479)

MetaCyc: 75% identical to diguanylate cyclase DgcC (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"Protein YaiC"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>GFF4282 Protein YaiC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MFPKIMNDENFYRKAVEQAVAPPDPPDDRQRSGLRFARRIRLPRAVGLGGMFLPVAAVLV
TQPVFGGWWLLLVGWSFVWPHLAWQWAAKALDPLRQEIYNLKVDAILSGMWIALMGVNML
PAAALFMMMSMNLMGAGGRRLFTVGMGLLLASCLVTLQLAGLPVAMRSSSLEVTLSLPVI
MLYPLLFAWVSYQTAIKLAEHKRRLQAMSSRDGMTGVYNRRHWEILLRNEFDHSRRHHRE
ATLLIIDIDHFKSINDTWGHDVGDEAIIALTRQLQITLRGSDIIGRFGGDEFAVIMCGTP
ADSAITAMSRVHERLNTLRLPGAPQVMLRISVGVAPLTPQIGHYREWLKSADMALYKAKN
AGRNRTEVAA