Protein Info for GFF4281 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Phosphate starvation-inducible protein PsiF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07769: PsiF_repeat
  • amino acids 27 to 59 (33 residues), 61.2 bits, E=3.3e-21
  • amino acids 71 to 103 (33 residues), 61.3 bits, E=3.1e-21

Best Hits

Swiss-Prot: 91% identical to PSIF_ECOL6: Phosphate starvation-inducible protein PsiF (psiF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 99% identity to set:SEN0367)

Predicted SEED Role

"Phosphate starvation-inducible protein PsiF"

Protein Sequence (106 amino acids)

>GFF4281 Phosphate starvation-inducible protein PsiF (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKITLLVTLLFGLVFLTAVGATEKPLTPQQQRMTTCNQQATAQALKGDARKTYLSDCLKN
SQSAPGEKSLTPQQQKMRECNVQATEQSLKGDDRSKFMSACLKKAA