Protein Info for PS417_21920 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00126: HTH_1" amino acids 4 to 63 (60 residues), 65.8 bits, see alignment E=2.7e-22 PF03466: LysR_substrate" amino acids 88 to 294 (207 residues), 133.9 bits, see alignment E=5.4e-43

Best Hits

Swiss-Prot: 46% identical to YHJC_ECOLI: Uncharacterized HTH-type transcriptional regulator YhjC (yhjC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU4799)

Predicted SEED Role

"Probable transcription regulator protein of MDR efflux pump cluster" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UQM7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PS417_21920 transcriptional regulator (Pseudomonas simiae WCS417)
MNKLELLRTFVRVTELSSFTQAGESLGLPRSTVSEHVQALEQLLGTRLLQRTTRKVQVTQ
DGRVLYERSKDLLSHMEELEGLFRQDEAQLTGRIRVDMPNVMARGMILPHLPLFMERHPL
IQMEISSSDRQVDLIAEGFDCVLRVGAQPDQTVVARRVCSMPMVNCASPAYLQRYGVPQT
LSDLADHQLVHYVRPLGARSSGFEYQSGGKVQRVPMAGRVTVNSTDAYQAACLGGFGITQ
VPLLGIRALLASGELVSVLPDYPAPPLDVSLLYAGQRHLPLRVRVFMDWLAATLQAHL