Protein Info for PS417_21890 in Pseudomonas simiae WCS417

Annotation: magnesium transporter CorA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 transmembrane" amino acids 279 to 302 (24 residues), see Phobius details amino acids 315 to 334 (20 residues), see Phobius details PF01544: CorA" amino acids 48 to 332 (285 residues), 155.5 bits, see alignment E=1e-49

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 98% identity to pfs:PFLU4793)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMC9 at UniProt or InterPro

Protein Sequence (340 amino acids)

>PS417_21890 magnesium transporter CorA (Pseudomonas simiae WCS417)
MNHSIDHSHQDSDLFGLLYGFRFRPGEKGEQIDSATAIQALRQPGDPEEFMWLHLNLAHA
ACERWMQANLDLPEEFFEALHEGSRSTRIEHVDSALLAVVNDVVFNFSSMVSSDISTLWV
CARSRLLISARLQPLHSVDKLRSSVKAGEGFRSPLALLVHLLRDQGEVLTQIVRKTSISV
DHIEDQLLSSRLSTNRAELGAARRVLVRLQRLLALEPGSLLRLLNRPPQWLQKEDVKELR
KSTEEFALIINDLMALGERIKLLQEEIAANLNEQSNRTLFTLTVVTVLALPINIIAGFFG
MNVGGVPLSQDPEGFWILVALVATFTLIAGRWAFRKRKDY