Protein Info for GFF4270 in Pseudomonas sp. DMC3

Annotation: Transcriptional regulator SlyA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 PF12802: MarR_2" amino acids 35 to 85 (51 residues), 33.6 bits, see alignment E=3.5e-12 PF13463: HTH_27" amino acids 36 to 94 (59 residues), 24.6 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 35% identical to SLYA_ECO27: Transcriptional regulator SlyA (slyA) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K06075, MarR family transcriptional regulator, transcriptional regulator for hemolysin (inferred from 93% identity to pfo:Pfl01_0170)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (142 amino acids)

>GFF4270 Transcriptional regulator SlyA (Pseudomonas sp. DMC3)
MNISSAMVVAARHWRKICQTTLVNYGISEACAVPLLMIGRLGEGVRQVQVAQAAGMESPS
LVRLLDQLCHAGYVCRTEDALDRRAKCLSLTDTGRELVQAVEAELVRLRHEVLEGIERSD
LEATLRVLRAFEAASSPVVVNS