Protein Info for GFF4264 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Molybdenum cofactor biosynthesis protein MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 31 to 371 (341 residues), 386.2 bits, see alignment E=5.9e-120 PF04055: Radical_SAM" amino acids 44 to 213 (170 residues), 119 bits, see alignment E=3.7e-38 PF13353: Fer4_12" amino acids 48 to 159 (112 residues), 30.1 bits, see alignment E=8.3e-11 PF06463: Mob_synth_C" amino acids 221 to 347 (127 residues), 133 bits, see alignment E=9.3e-43

Best Hits

Swiss-Prot: 68% identical to MOAA_RALSO: GTP 3',8-cyclase (moaA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 74% identity to aav:Aave_2659)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>GFF4264 Molybdenum cofactor biosynthesis protein MoaA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSERVIPLIDQRLASVPARVPPVASAPTGWLVDARGRPLRDLRISVTDRCNFRCSYCMPK
DIFDKDYPYLPHSSLLTFEEITRVARQFVAHGVQKIRLTGGEPLLRKNLEILIEQLAALR
TVEGEPLDITLTTNGSLLARKANALKAAGLRRVTVSLDGLDDTIFRAMNDVDFPVADVLD
GIAAAQAAGLGPIKVNMVVKRGTNDHEILAMARHFKGTGIVLRFIEYMDVGATNGWRMDE
VMPSAEVVQRIHRELPLVQLDASAPGETAERWAYADGSGEIGVISSVTQAFCSDCNRARL
STEGQLYLCLFASQGHDLRHLIRGNATDEQLASAIAAIWQGRSDRYSELRASLPPEAGAG
TRRVEMSYIGG