Protein Info for GFF4262 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Molybdopterin biosynthesis protein MoeA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 312 to 332 (21 residues), see Phobius details PF03453: MoeA_N" amino acids 28 to 184 (157 residues), 136.1 bits, see alignment E=1.3e-43 TIGR00177: molybdenum cofactor synthesis domain" amino acids 194 to 334 (141 residues), 105 bits, see alignment E=1.7e-34 PF00994: MoCF_biosynth" amino acids 199 to 337 (139 residues), 120.7 bits, see alignment E=6.4e-39 PF03454: MoeA_C" amino acids 351 to 422 (72 residues), 72.1 bits, see alignment E=5.3e-24

Best Hits

Swiss-Prot: 44% identical to MOEA_ECOLI: Molybdopterin molybdenumtransferase (moeA) from Escherichia coli (strain K12)

KEGG orthology group: K03750, molybdopterin biosynthesis protein MoeA (inferred from 67% identity to vap:Vapar_2341)

MetaCyc: 44% identical to molybdopterin molybdotransferase (Escherichia coli K-12 substr. MG1655)
RXN-8348 [EC: 2.10.1.1]

Predicted SEED Role

"Molybdopterin biosynthesis protein MoeA" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.10.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>GFF4262 Molybdopterin biosynthesis protein MoeA (Hydrogenophaga sp. GW460-11-11-14-LB1)
LSMKSIEQIAAELQGYDPQAISAERVNDFLARLVEPVTATEDLGVFDALGRVLAQDVVSP
ISVPPHDNSAMDGFAFDSRQLRPGEPLGLRVVGTAFAGKAWAGAVGAGECLKIMTGAIMP
AGLDTVVPLEFVKAEGERIEVPPNVVSAGDNRRLLGEDLMAGEAALRQGQALGPAALGLL
ASLGLPSVKVFRRVKVAYFSTGDEILSLGEAPREGAVYDSNRYTVFGLLTRLGVEVIDMG
VVRDEPADLEAAFRTAALKADAIITSGGVSMGEADHTKAMMKQLGDVAFWRIAMRPGRPM
AVGRIDEAGKSAVLFGLPGNPVAVMVTFLAFVRPALQRLMGGTASAPVLLQARSGEALRK
KPGRTEYQRGIVTRTPDGALSVRTTGNQGSGVLSSMVEANGLIVLHHSQGNVAVGDPVDV
MMFDGAI