Protein Info for GFF4259 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details PF01810: LysE" amino acids 17 to 206 (190 residues), 191.9 bits, see alignment E=4.1e-61 TIGR00949: homoserine/Threonine efflux protein" amino acids 20 to 202 (183 residues), 229.7 bits, see alignment E=1.1e-72

Best Hits

Swiss-Prot: 87% identical to YAHN_ECOLI: Uncharacterized membrane protein YahN (yahN) from Escherichia coli (strain K12)

KEGG orthology group: K03329, hypothetical protein (inferred from 100% identity to see:SNSL254_A0405)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (210 amino acids)

>GFF4259 Threonine efflux protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEPFHAVVLTVSLFVLTFFNPGANLFVVVQTSLASGRRAGVITGLGVATGDAFYSGLGLF
GLATLITQCEAVFSLIKIVGGAYLLWFAWNSIRHQATPQMSTLQTPIAAPWTIFFRRGLM
TDLSNPQTVLFFISIFSVTLSAETPTWARLMAWAGIVLSSVIWRIFLSQAFSLPAVRRAY
GRIQRIASRVIGAIIGMFALRLLYEGVTHR