Protein Info for GFF4255 in Xanthobacter sp. DMC5

Annotation: (R)-specific enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 PF13452: FAS1_DH_region" amino acids 16 to 130 (115 residues), 23.1 bits, see alignment E=1.1e-08 PF01575: MaoC_dehydratas" amino acids 21 to 109 (89 residues), 83.9 bits, see alignment E=1.1e-27 PF03061: 4HBT" amino acids 71 to 110 (40 residues), 23.5 bits, see alignment E=8.4e-09

Best Hits

Swiss-Prot: 79% identical to CROR_METEA: 3-hydroxybutyryl-CoA dehydratase (croR) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)

KEGG orthology group: None (inferred from 93% identity to xau:Xaut_2482)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>GFF4255 (R)-specific enoyl-CoA hydratase (Xanthobacter sp. DMC5)
MFLELQNLFFEDLTVGRIERMSKTVSSSDIVGFAELTGDRNPIHLSQHFAARTPFGGRIA
HGLYTASLISAVLGTRLPGPGAVYISQTLNFRAPVRIDDTVEVEVRVVELIPERFRARLS
CICTVKGEVVLDGEAWVKVPSAATQKVASA