Protein Info for GFF4253 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00615: recombination protein RecR" amino acids 5 to 203 (199 residues), 223.6 bits, see alignment E=8e-71 PF21176: RecR_HhH" amino acids 8 to 50 (43 residues), 77.3 bits, see alignment 1.6e-25 PF02132: RecR_ZnF" amino acids 54 to 74 (21 residues), 25.5 bits, see alignment (E = 2.3e-09) PF13662: Toprim_4" amino acids 80 to 178 (99 residues), 85.7 bits, see alignment E=5.4e-28 PF01751: Toprim" amino acids 81 to 167 (87 residues), 32.7 bits, see alignment E=1.7e-11 PF21175: RecR_C" amino acids 180 to 203 (24 residues), 40 bits, see alignment (E = 5.2e-14)

Best Hits

Swiss-Prot: 77% identical to RECR_POLSJ: Recombination protein RecR (recR) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K06187, recombination protein RecR (inferred from 77% identity to pol:Bpro_2270)

MetaCyc: 56% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>GFF4253 Recombination protein RecR (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAENHSLELLVQALRRLPGVGVKSAQRMAFHLLQHDRDGAVQLARALEHAASSVKHCNLC
NTFTENDICATCQDPRRDRGQLCVVETPADQAAMERTGAYKGLFFVLMGKLSPLDGVGPR
DIGLQKLFDRISAPAELGEPEVREVILATNFTAEGETTAHVIAQALKGRTDVQVTRLARG
VPVGSELEYVDLGTIAHALVDRR