Protein Info for PS417_21740 in Pseudomonas simiae WCS417

Updated annotation (from data): ABC transporter for L-Arginine, permease component 1
Rationale: Specific phenotypes on L-Arginine; L-Arginine. KEGG annotation has been updated since the last public release (KEGG_correct)
Original annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 13 to 39 (27 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 115 (108 residues), 67.8 bits, see alignment E=4.8e-23 PF00528: BPD_transp_1" amino acids 32 to 221 (190 residues), 87.6 bits, see alignment E=4.6e-29

Best Hits

Swiss-Prot: 54% identical to HISQ_SALTY: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to pba:PSEBR_a4323)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UMA0 at UniProt or InterPro

Protein Sequence (229 amino acids)

>PS417_21740 ABC transporter for L-Arginine, permease component 1 (Pseudomonas simiae WCS417)
MLKGYGAVILDGAWLTLQLALSSMALAIVLGLIGVALRLSPVRWLAWLGDLYSTVIRGIP
DLVLILLIFYGGQDLLNRVAPMLGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAI
PKGQAEAGLAYGMSSFQVFFRVMVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFK
AKQAADATREPFTFFLAVAAMYLVITSVSLLALRHLEKRYSVGVRAADL