Protein Info for GFF4234 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 43 to 60 (18 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 118 to 281 (164 residues), 54.4 bits, see alignment E=7e-19

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 86% identity to xau:Xaut_3453)

Predicted SEED Role

"Taurine transport system permease protein TauC" in subsystem Taurine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>GFF4234 hypothetical protein (Xanthobacter sp. DMC5)
MSDIDLSRQPALFRVAHATTRTAPAQWLATAGAGLWRFTLVRRLVVLAGLAVLWQVAATW
QNSPLLFPTFTDTISALVEALRHEDLFPASIASLTVLVKGYVLALALALVFVSVAIAVPF
VKEVLLTLTAMFNPLPAIALLPLAMLWLGLGEASLLLVMVHAVLWPFALAALTGFEQVPE
TQRLVGRNYGLKGPAYVALILIPAALPSLLSGLKIAWAFAWRTLIAAELVFGVSSRSGGL
GWFIYRNRNELLTDRVFAGLVTVILIGLLVEVLFRLVEQRTVRAWGLQR