Protein Info for GFF4233 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Fimbrial protein precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00419: Fimbrial" amino acids 28 to 178 (151 residues), 64.1 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K07345, major type 1 subunit fimbrin (pilin) (inferred from 99% identity to sed:SeD_A0371)

Predicted SEED Role

"Fimbrial protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (178 amino acids)

>GFF4233 Fimbrial protein precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVINGNQAKPVVLLPTVSTK
DLSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTSNGNLGNTGSAKNVEVQLL
DTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTGKAEAGTVAATLQYAVSYK